Recombinant Human DAN domain family member 5 (DAND5) | CSB-EP850835HU

(No reviews yet) Write a Review
SKU:
CSB-EP850835HU
Availability:
13 - 23 Working Days
  • Recombinant Human DAN domain family member 5 (DAND5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human DAN domain family member 5 (DAND5) | CSB-EP850835HU | Cusabio

Alternative Name(s): Cerberus-like protein 2 ;Cerl-2;Cysteine knot superfamily 1, BMP antagonist 3Gremlin-3

Gene Names: DAND5

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-189aa

Sequence Info: Full Length of Mature Protein

MW: 34.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ses to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation .

Reference: Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.Katoh M., Katoh M.Oncol. Rep. 12:423-427(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: DAN family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8N907

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose