Recombinant Human D-amino acid oxidase activator (DAOA) | CSB-EP006495HU

(No reviews yet) Write a Review
SKU:
CSB-EP006495HU
Availability:
13 - 23 Working Days
  • Recombinant Human D-amino acid oxidase activator (DAOA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human D-amino acid oxidase activator (DAOA) | CSB-EP006495HU | Cusabio

Alternative Name(s): Protein G72

Gene Names: DAOA

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-153aa

Sequence Info: Full Length

MW: 45.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ses to activate D-amino acid oxidase.

Reference: An unappreciated role for RNA surveillance.Hillman R.T., Green R.E., Brenner S.E.Genome Biol. 5:R8.1-R8.16(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Seems to activate D-amino acid oxidase.

Involvement in disease: Schizophrenia (SCZD)

Subcellular Location: Golgi apparatus

Protein Families:

Tissue Specificity: Expressed in amygdala, caudate nucleus, spinal cord and testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P59103

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose