Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active) | CSB-MP006163HU1

(No reviews yet) Write a Review
SKU:
CSB-MP006163HU1
Availability:
3 to 7 Working Days
  • Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4) ,partial (Active)
  • Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$219.60 - $336.00

Description

Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4) ,partial (Active) | CSB-MP006163HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) : Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)

Gene Names: CTLA4

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 37-162aa

Sequence Info: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody (CSB-RA213310A0HU) , the EC50 of human CD152 protein is 27.14-34.82 ng/ml.

MW: 42.5 kDa

Purity: Greater than 91% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16410

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose