Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase (ENGASE) | CSB-EP854117HU

(No reviews yet) Write a Review
SKU:
CSB-EP854117HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase (ENGASE)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Cytosolic endo-beta-N-acetylglucosaminidase (ENGASE) | CSB-EP854117HU | Cusabio

Alternative Name(s): Cytosolic endo-beta-N-acetylglucosaminidase; DKFZp434P174; ENASE_HUMAN; ENGase; FLJ21865; Mannosyl glycoprotein endo beta N acetylglucosaminidase

Gene Names: ENGASE

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-377aa

Sequence Info: Full Length of Isoform 2

MW: 59.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol.

Reference: "Endo-beta-N-acetylglucosaminidase, an enzyme involved in processing of free oligosaccharides in the cytosol." Suzuki T., Yano K., Sugimoto S., Kitajima K., Lennarz W.J., Inoue S., Inoue Y., Emori Y. Proc. Natl. Acad. Sci. U.S.A. 99:9691-9696(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Endoglycosidase that releases N-glycans from glycoproteins by cleaving the beta-1,4-glycosidic bond in the N,N'-diacetylchitobiose core. Involved in the processing of free oligosaccharides in the cytosol.

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol

Protein Families: Glycosyl hydrolase 85 family

Tissue Specificity: Widely expressed. Expressed at higher level in thymus and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8NFI3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose