Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) | CSB-EP517245HWWe1

(No reviews yet) Write a Review
SKU:
CSB-EP517245HWWe1
Availability:
3 - 7 Working Days
  • Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$487.20 - $2,172.00

Description

Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) | CSB-EP517245HWWe1 | Cusabio

Alternative Name(s): UL111A; Viral interleukin-10 homolog; cmvIL-10; vIL-10

Gene Names: UL111A

Research Areas: Others

Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

AA Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Source: E.coli

Tag Info: Tag-Free

Expression Region: 26-176aa

Sequence Info: Full Length of Mature Protein

MW: 17.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.

Reference: "Two novel spliced genes in human cytomegalovirus." Akter P., Cunningham C., McSharry B.P., Dolan A., Addison C., Dargan D.J., Hassan-Walker A.F., Emery V.C., Griffiths P.D., Wilkinson G.W., Davison A.J. J. Gen. Virol. 84:1117-1122(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-10 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F5HC71

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose