Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) | CSB-EP517245HWW

(No reviews yet) Write a Review
SKU:
CSB-EP517245HWW
Availability:
13 - 23 Working Days
$357.60 - $2,042.40

Description

Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) | CSB-EP517245HWW | Cusabio

Alternative Name(s): cmvIL-10 (vIL-10)

Gene Names: UL111A

Research Areas: Others

Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

AA Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged

Expression Region: 26-176aa

Sequence Info: Full Length of Mature Protein

MW: 36

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.

Reference: "Genetic content of wild-type human cytomegalovirus." Dolan A., Cunningham C., Hector R.D., Hassan-Walker A.F., Lee L., Addison C., Dargan D.J., McGeoch D.J., Gatherer D., Emery V.C., Griffiths P.D., Sinzger C., McSharry B.P., Wilkinson G.W.G., Davison A.J. J. Gen. Virol. 85:1301-1312(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F5HC71

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose