Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial | CSB-BP011651HU3(M)

Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial | CSB-BP011651HU3(M) | Cusabio

Alternative Name(s): Cytokine receptor common subunit gamma(Interleukin-2 receptor subunit gamma)(IL-2 receptor subunit gamma)(IL-2R subunit gamma)(IL-2RG)(gammaC)(p64)(CD antigen CD132)

Gene Names: IL2RG

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Source: Baculovirus

Tag Info: C-terminal 6xHis-tagged

Expression Region: 56-254aa(N75Q)

Sequence Info: Partial

MW: 25.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (PubMed:15123770).

Reference: "Interleukin-15 enhances human neutrophil phagocytosis by a Syk-dependent mechanism: importance of the IL-15Ralpha chain." Ratthe C., Girard D. J. Leukoc. Biol. 76:162-168(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31785

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A