Cusabio Human Recombinants
Recombinant Human Cytochrome P450 2C9 (CYP2C9) | CSB-EP006419HU
- SKU:
- CSB-EP006419HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Cytochrome P450 2C9 (CYP2C9) | CSB-EP006419HU | Cusabio
Alternative Name(s): (R)-limonene 6-monooxygenase ((S)-limonene 6-monooxygenase) ((S)-limonene 7-monooxygenase) (CYPIIC9) (Cholesterol 25-hydroxylase1 Publication) (Cytochrome P-450MP) (Cytochrome P450 MP-4) (Cytochrome P450 MP-8) (Cytochrome P450 PB-1) (S-mephenytoin 4-hydroxylase) (CYP2C10)
Gene Names: CYP2C9
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-162aa
Sequence Info: Full Length of Isoform 2
MW: 25.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This enzyme contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan.
Reference: "Nucleotide sequence of a human liver cytochrome P-450 related to the rat male specific form." Yasumori T., Kawano S., Nagata K., Shimada M., Yamazoe Y., Kato R. J. Biochem. 102:1075-1082(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P11712
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A