Recombinant Human Cytochrome c-type heme lyase (HCCS) | CSB-EP010165HU

Recombinant Human Cytochrome c-type heme lyase (HCCS) | CSB-EP010165HU | Cusabio

Alternative Name(s): Holocytochrome c-type synthase

Gene Names: HCCS

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-268aa

Sequence Info: Full Length

MW: 57.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Links covalently the heme group to the apoprotein of cytochrome c.

Reference: "Genomic structure of a human holocytochrome c-type synthetase gene in Xp22.3 and mutation analysis in patients with Rett syndrome." van den Veyver I.B., Subramanian S., Zoghbi H.Y. Am. J. Med. Genet. 78:179-181(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Links covalently the heme group to the apoprotein of cytochrome c.

Involvement in disease: Linear skin defects with multiple congenital anomalies 1 (LSDMCA1)

Subcellular Location: Mitochondrion inner membrane, Membrane, Lipid-anchor

Protein Families: Cytochrome c-type heme lyase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P53701

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM