Recombinant Human Cytochrome c (CYCS) | CSB-EP006328HU

(No reviews yet) Write a Review
SKU:
CSB-EP006328HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cytochrome c (CYCS)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Cytochrome c (CYCS) | CSB-EP006328HU | Cusabio

Alternative Name(s): CYC; CYC_HUMAN; CYCS; Cytochrome c; Cytochrome c somatic; HCS; THC4

Gene Names: CYCS

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-105aa

Sequence Info: Full Length of Mature Protein

MW: 38.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Electron carrier protein. The oxidized form of the cytochrome c he group can accept an electron from the he group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.Plays a role in apoptosis. Suppression of the anti-apoptotic mbers or activation of the pro-apoptotic mbers of the Bcl-2 family leads to altered mitochondrial mbrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.

Reference: The human somatic cytochrome c gene two classes of processed pseudogenes demarcate a period of rapid molecular evolution.Evans M.J., Scarpulla R.C.Proc. Natl. Acad. Sci. U.S.A. 85:9625-9629(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.; FUNCTION

Involvement in disease: Thrombocytopenia 4 (THC4)

Subcellular Location: Mitochondrion intermembrane space

Protein Families: Cytochrome c family

Tissue Specificity:

Paythway: p53signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P99999

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose