null

Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10) | CSB-EP890670HU

(No reviews yet) Write a Review
SKU:
CSB-EP890670HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00
Frequently bought together:

Description

Recombinant Human Cytochrome b-c1 complex subunit 9 (UQCR10) | CSB-EP890670HU | Cusabio

Alternative Name(s): Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein

Gene Names: UQCR10

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-63aa

Sequence Info: Full Length

MW: 34.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1

Reference: "Ubiquinol-cytochrome-c reductase from human and bovine mitochondria." Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane

Protein Families: UQCR10/QCR9 family

Tissue Specificity:

Paythway: Cardiacmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UDW1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose