Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1) | CSB-CF006465HU

(No reviews yet) Write a Review
SKU:
CSB-CF006465HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£1,172.80 - £1,870.40

Description

Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1) | CSB-CF006465HU | Cusabio

Alternative Name(s): CysLTR1;Cysteinyl leukotriene D4 receptor;LTD4 receptor;G-protein coupled receptor HG55;HMTMF81

Gene Names: CYSLTR1

Research Areas: others

Organism: Homo sapiens (Human)

AA Sequence: MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-337aa

Sequence Info: Full Length

MW: 44.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.

Reference: "Identification, molecular cloning, expression, and characterization of a cysteinyl leukotriene receptor." Sarau H.M., Ames R.S., Chambers J., Ellis C., Elshourbagy N., Foley J.J., Schmidt D.B., Muccitelli R.M., Jenkins O., Murdock P.R., Herrity N.C., Halsey W., Sathe G., Muir A.I., Nuthulaganti P., Dytko G.M., Buckley P.T., Wilson S., Bergsma D.J., Hay D.W.P. Mol. Pharmacol. 56:657-663(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y271

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose