Cusabio Human Recombinants
Recombinant Human Cysteine-rich protein 2 (CRIP2) | CSB-EP005970HU
- SKU:
- CSB-EP005970HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Cysteine-rich protein 2 (CRIP2) | CSB-EP005970HU | Cusabio
Alternative Name(s): Protein ESP1
Gene Names: P52943
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-208aa
Sequence Info: Full Length
MW: 38.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: Human ESP1/CRP2, a member of the LIM domain protein family characterization of the cDNA and assignment of the gene locus to chromosome 14q32.3.Karim M.A., Ohta K., Egashira M., Jinno Y., Niikawa N., Matsuda I., Indo Y.Genomics 31:167-176(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity: Widespread tissue expression; highest levels in the heart.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P52943
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: OMIM