Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2) | CSB-RP069374h

Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2) | CSB-RP069374h | Cusabio

Alternative Name(s): Cysteine-rich protein 2 ;CRP2LIM domain only protein 5 ;LMO-5Smooth muscle cell LIM protein ;SmLIM

Gene Names: CSRP2

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-193aa

Sequence Info: Full Length of Mature Protein

MW: 24.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Ses to play a role in the development of the bryonic vascular syst.

Reference: Molecular cloning and characterization of SmLIM, a developmentally regulated LIM protein preferentially expressed in aortic smooth muscle cells.Jain M., Fujita K.P., Hsieh C.-M., Endege W.O., Sibinga N.E.S., Yet S.-F., Kashiki S., Lee W.-S., Perrella M.A., Haber E., Lee M.-E.J. Biol. Chem. 271:10194-10199(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity: Highly expressed in the aorta, but not in heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q16527

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM