Recombinant Human Cystatin-B (CSTB) | CSB-EP006100HUe0

(No reviews yet) Write a Review
SKU:
CSB-EP006100HUe0
Availability:
3 - 7 Working Days
  • Recombinant Human Cystatin-B (CSTB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Cystatin-B (CSTB) | CSB-EP006100HUe0 | Cusabio

Alternative Name(s): CPI-BLiver thiol proteinase inhibitorStefin-B

Gene Names: CSTB

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-98aa

Sequence Info: Full Length

MW: 38.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Reference: Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver.Ritonja A., Machleidt W., Barrett A.J.Biochem. Biophys. Res. Commun. 131:1187-1192(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Involvement in disease: Epilepsy, progressive myoclonic 1 (EPM1)

Subcellular Location: Cytoplasm, Nucleus

Protein Families: Cystatin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04080

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose