Cusabio Human Recombinants
Recombinant Human Cystatin-B (CSTB) | CSB-EP006100HU
- SKU:
- CSB-EP006100HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Cystatin-B (CSTB) | CSB-EP006100HU | Cusabio
Alternative Name(s): CPI-B Liver thiol proteinase inhibitor Stefin-B
Gene Names: CSTB
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-98aa
Sequence Info: Full Length
MW: 27.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Reference: "Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver." Ritonja A., Machleidt W., Barrett A.J. Biochem. Biophys. Res. Commun. 131:1187-1192(1985)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Involvement in disease: Epilepsy, progressive myoclonic 1 (EPM1)
Subcellular Location: Cytoplasm, Nucleus
Protein Families: Cystatin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04080
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM