Recombinant Human Cystatin-9 (CST9) | CSB-EP719636HU

(No reviews yet) Write a Review
SKU:
CSB-EP719636HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cystatin-9 (CST9)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Cystatin-9 (CST9) | CSB-EP719636HU | Cusabio

Alternative Name(s): Cystatin-like molecule

Gene Names: CST9

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: WCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-159aa

Sequence Info: Full Length of Mature Protein

MW: 18.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation (PubMed:12535658). Has immunomodulatory and antimicrobial functions against Francisella tularensis, a Gram-negative bacteria (PubMed:23922243).

Reference: "Molecular cloning and characterization of a novel cystatin-like molecule, CLM, from human bone marrow stromal cells."Sun H., Li N., Wang X., Liu S., Chen T., Zhang L., Wan T., Cao X.Biochem. Biophys. Res. Commun. 301:176-182(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in testis development (By similarity). May play a role in hematopoietic differentiation or inflammation

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Cystatin family

Tissue Specificity: Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas (PubMed:12535658). Not expressed in brain (PubMed:12535658). Expressed in epididymis, kidney, testis, spinal cord, and thymus with a strong expression in epididymis and kidney and a weak expression in the spinal cord and thymus (PubMed:20565543).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5W186

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose