Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D) | CSB-EP005095HU

(No reviews yet) Write a Review
SKU:
CSB-EP005095HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D) | CSB-EP005095HU | Cusabio

Alternative Name(s): p19-INK4d

Gene Names: CDKN2D

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-166aa

Sequence Info: Full Length

MW: 44.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Interacts strongly with CDK4 and CDK6 and inhibits them

Reference: "Mutation testing in melanoma families: INK4A, CDK4 and INK4D." Newton Bishop J.A., Harland M., Bennett D.C., Bataille V., Goldstein A.M., Tucker M.A., Ponder B.A.J., Cuzick J., Selby P., Bishop D.T. Br. J. Cancer 80:295-300(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Interacts strongly with CDK4 and CDK6 and inhibits them.

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasm

Protein Families: CDKN2 cyclin-dependent kinase inhibitor family

Tissue Specificity:

Paythway: Cellcycle

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55273

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose