Recombinant Human Cyclin-A1 Isoform 2 (CCNA1), partial | CSB-BP004804HU

Recombinant Human Cyclin-A1 Isoform 2 (CCNA1), partial | CSB-BP004804HU | Cusabio

Alternative Name(s): CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139

Gene Names: CCNA1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLL

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-464aa

Sequence Info: Extracellular Domain

MW: 54.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.

Reference: "Functions of cyclin A1 in the cell cycle and its interactions with transcription factor E2F-1 and the Rb family of proteins."Yang R., Mueller C., Huynh V., Fung Y.K., Yee A.S., Koeffler H.P.Mol. Cell. Biol. 19:2400-2407(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Cyclin family, Cyclin AB subfamily

Tissue Specificity: Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.

Paythway: Cellcycle

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P78396

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM