Recombinant Human CXXC-type zinc finger protein 4 (CXXC4) | CSB-EP875656HU

Recombinant Human CXXC-type zinc finger protein 4 (CXXC4) | CSB-EP875656HU | Cusabio

Alternative Name(s): Inhibition of the Dvl and axin complex protein

Gene Names: CXXC4

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-198aa

Sequence Info: Full Length

MW: 48 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1

Reference: "Inhibition of the Wnt signaling pathway by Idax, a novel Dvl-binding protein." Hino S., Kishida S., Michiue T., Fukui A., Sakamoto I., Takada S., Asashima M., Kikuchi A. Mol. Cell. Biol. 21:330-342(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H2H0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: OMIM