Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D, L408A, P409A) | CSB-EP846108HU(F2)(M3)

Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D, L408A, P409A) | CSB-EP846108HU(F2)(M3) | Cusabio

Alternative Name(s): CELF-1;50 kDa nuclear polyadenylated RNA-binding protein;Bruno-like protein 2;CUG triplet repeat RNA-binding protein 1;CUG-BP1;CUG-BP- and ETR-3-like factor 1;Deadenylation factor CUG-BP;Embryo deadenylation element-binding protein homolog;EDEN-BP homolog;RNA-binding protein BRUNOL-2

Gene Names: CELF1

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSDPLDVLTSSGDDPDSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHAAQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

Source: E.coli

Tag Info: Tag-Free

Expression Region: 1-482aa (T173E,S178D,S285D,S288D,S295D,S296D,S298D,L404A,P405A)

Sequence Info: Full Length

MW: 53.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference:

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q92879

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A