Recombinant Human Craniofacial development protein 1 (CFDP1) | CSB-EP005272HU

(No reviews yet) Write a Review
SKU:
CSB-EP005272HU
Availability:
13 - 23 Working Days
  • Recombinant Human Craniofacial development protein 1 (CFDP1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human Craniofacial development protein 1 (CFDP1) | CSB-EP005272HU | Cusabio

Alternative Name(s): Bucentaur

Gene Names: CFDP1

Research Areas: Stem Cells

Organism: Homo sapiens (Human)

AA Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-299aa

Sequence Info: Full Length

MW: 60.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role during embryogenesis

Reference: "An Alu-linked repetitive sequence corresponding to 280 amino acids is expressed in a novel bovine protein, but not in its human homologue." Nobukuni T., Kobayashi M., Omori A., Ichinose S., Iwanaga T., Takahashi I., Hashimoto K., Hattori S., Kaibuchi K., Miyata Y., Masui T., Iwashita S. J. Biol. Chem. 272:2801-2807(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role during embryogenesis.

Involvement in disease:

Subcellular Location: Chromosome, centromere, kinetochore

Protein Families:

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UEE9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose