Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2 (HSD11B2) | CSB-YP010765HU

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2 (HSD11B2) | CSB-YP010765HU | Cusabio

Alternative Name(s): 11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase ;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3

Gene Names: HSD11B2

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-405aa

Sequence Info: Full Length

MW: 46.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.

Reference: Cloning and tissue distribution of the human 11 beta-hydroxysteroid dehydrogenase type 2 enzyme.Albiston A.L., Obeyesekere V.R., Smith R.E., Krozowski Z.S.Mol. Cell. Endocrinol. 105:R11-R17(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.

Involvement in disease: Apparent mineralocorticoid excess (AME)

Subcellular Location: Microsome, Endoplasmic reticulum

Protein Families: Short-chain dehydrogenases/reductases (SDR) family

Tissue Specificity: Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P80365

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM