Recombinant Human coronavirus NL63 Nucleoprotein (N) | CSB-EP744150HIX

Recombinant Human coronavirus NL63 Nucleoprotein (N) | CSB-EP744150HIX | Cusabio

Target Name: N

Uniprot No: Q6Q1R8

Species: Human coronavirus NL63 (HCoV-NL63)

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-377aa

Sequence Description: Full Length

Target Protein Sequence: MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Mol. Weight: 48.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.