Cusabio Covid-19 Recombinants
Recombinant Human coronavirus NL63 Nucleoprotein (N) | CSB-BP744150HIX
- SKU:
- CSB-BP744150HIX
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human coronavirus NL63 Nucleoprotein (N) | CSB-BP744150HIX | Cusabio
Target Name: N
Uniprot No: Q6Q1R8
Species: Human coronavirus NL63 (HCoV-NL63)
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-377aa
Sequence Description: Full Length
Target Protein Sequence: MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH
Mol. Weight: 46.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test.
Biological Activity: N/A
Form: Lyophilized powder
Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.