Recombinant Human coronavirus NL63 Envelope small membrane protein (E) | CSB-CF764822HIX

Recombinant Human coronavirus NL63 Envelope small membrane protein (E) | CSB-CF764822HIX | Cusabio

Target Name: E

Uniprot No: Q6Q1S0

Species: Human coronavirus NL63 (HCoV-NL63)

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-77aa

Sequence Description: Full Length

Target Protein Sequence: MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV

Mol. Weight: 12.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.