Recombinant Human coronavirus HKU1 Spike glycoprotein (S) , partial | CSB-EP708794HIU

Recombinant Human coronavirus HKU1 Spike glycoprotein (S) , partial | CSB-EP708794HIU | Cusabio

Target Name: S

Uniprot No: Q5MQD0

Species: Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 307-677aa

Sequence Description: Partial

Target Protein Sequence: SGFTVKPVATVHRRIPDLPDCDIDKWLNNFNVPSPLNWERKIFSNCNFNLSTLLRLVHTDSFSCNNFDESKIYGSCFKSIVLDKFAIPNSRRSDLQLGSSGFLQSSNYKIDTTSSSCQLYYSLPAINVTINNYNPSSWNRRYGFNNFNLSSHSVVYSRYCFSVNNTFCPCAKPSFASSCKSHKPPSASCPIGTNYRSCESTTVLDHTDWCRCSCLPDPITAYDPRSCSQKKSLVGVGEHCAGFGVDEEKCGVLDGSYNVSCLCSTDAFLGWSYDTCVSNNRCNIFSNFILNGINSGTTCSNDLLQPNTEVFTDVCVDYDLYGITGQGIFKEVSAVYYNSWQNLLYDSNGNIIGFKDFVTNKTYNIFPCYAG

Mol. Weight: 46.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.