Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial | CSB-EP887030HU

(No reviews yet) Write a Review
SKU:
CSB-EP887030HU
Availability:
13 - 23 Working Days
  • Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial | CSB-EP887030HU | Cusabio

Alternative Name(s): Cell recognition molecule Caspr2

Gene Names: CNTNAP2

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: CDEPLVSGLPHGAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPVIARYVRVVPLDWNGEGRIGLRIEVYGC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 35-181aa

Sequence Info: Partial

MW: 20.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required, with CNTNAP1, for radial and longitudinal organization of myelinated axons. Plays a role in the formation of functional distinct domains critical for saltatory conduction of nerve impulses in myelinated nerve fibers. Demarcates the juxtaparanodal region of the axo-glial junction.

Reference: "The human contactin-associated protein-like 2 gene (CNTNAP2) spans over 2 Mb of DNA at chromosome 7q35." Nakabayashi K., Scherer S.W. Genomics 73:108-112(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHC6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose