Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial | CSB-YP005653HU

(No reviews yet) Write a Review
SKU:
CSB-YP005653HU
Availability:
25 - 35 Working Days
  • Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $1,131.60

Description

Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial | CSB-YP005653HU | Cusabio

Alternative Name(s): CNK homolog protein 2 ;CNK2

Gene Names: CNKSR2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 650-800aa

Sequence Info: Partial

MW: 19.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May function as an adapter protein or regulator of Ras signaling pathways.

Reference: Human homologue of Drosophila CNK interacts with Ras effector proteins Raf and Rlf.Lanigan T.M., Liu A., Huang Y.Z., Mei L., Margolis B., Guan K.-L.FASEB J. 17:2048-2060(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May function as an adapter protein or regulator of Ras signaling pathways.

Involvement in disease:

Subcellular Location: Cytoplasm, Membrane, Peripheral membrane protein

Protein Families: CNKSR family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8WXI2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose