Cusabio Human Recombinants
Recombinant Human Complement component C8 gamma chain (C8G) | CSB-EP004196HUa0
- SKU:
- CSB-EP004196HUa0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Complement component C8 gamma chain (C8G) | CSB-EP004196HUa0 | Cusabio
Alternative Name(s): C8C; C8G; CO8G_HUMAN; Complement component 8 gamma polypeptide; Complement component C8 gamma chain; MGC142186
Gene Names: C8G
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-202aa
Sequence Info: Full length
MW: 26.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
Reference: "Structural and functional characterization of complement C8 gamma, a member of the lipocalin protein family." Haefliger J.-A., Peitsch M.C., Jenne D.E., Tschopp J. Mol. Immunol. 28:123-131(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07360
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A