null

Recombinant Human Complement component C8 gamma chain (C8G) | CSB-EP004196HUa0

(No reviews yet) Write a Review
SKU:
CSB-EP004196HUa0
Availability:
3 - 7 Working Days
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human Complement component C8 gamma chain (C8G) | CSB-EP004196HUa0 | Cusabio

Alternative Name(s): C8C; C8G; CO8G_HUMAN; Complement component 8 gamma polypeptide; Complement component C8 gamma chain; MGC142186

Gene Names: C8G

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-202aa

Sequence Info: Full length

MW: 26.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.

Reference: "Structural and functional characterization of complement C8 gamma, a member of the lipocalin protein family." Haefliger J.-A., Peitsch M.C., Jenne D.E., Tschopp J. Mol. Immunol. 28:123-131(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07360

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose