Recombinant Human Complement C3 (C3), partial | CSB-RP105994h

(No reviews yet) Write a Review
SKU:
CSB-RP105994h
Availability:
3 - 7 Working Days
  • Recombinant Human Complement C3 (C3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Complement C3 (C3), partial | CSB-RP105994h | Cusabio

Alternative Name(s): C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1

Gene Names: C3

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-225aa

Sequence Info: Partial

MW: 26.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils . It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation.Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2

Reference: Human complement component C3 cDNA coding sequence and derived primary structure.de Bruijn M.H.L., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 82:708-712(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; FUNCTION

Involvement in disease: Complement component 3 deficiency (C3D); Macular degeneration, age-related, 9 (ARMD9); Hemolytic uremic syndrome atypical 5 (AHUS5)

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Plasma. The acylation stimulating protein (ASP) is expressed in adipocytes and released into the plasma during both the fasting and postprandial periods.

Paythway: Complementandcoagulationcascades

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01024

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose