Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3) | CSB-BP883621HU

(No reviews yet) Write a Review
SKU:
CSB-BP883621HU
Availability:
3 - 7 Working Days
£354.40 - £848.00

Description

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3) | CSB-BP883621HU | Cusabio

Alternative Name(s): Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26 ) (CTRP3)

Gene Names: C1QTNF3

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-246aa

Sequence Info: Full Length of Mature Protein

MW: 28.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Effects of the new C1q/TNF-related protein (CTRP-3) "cartonectin" on the adipocytic secretion of adipokines." Wolfing B., Buechler C., Weigert J., Neumeier M., Aslanidis C., Schoelmerich J., Schaffler A. Obesity (Silver Spring) 16:1481-1486(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Expressed in colon and small intestine.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BXJ4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose