Cusabio Human Recombinants
Recombinant Human Collectin-11 (COLEC11) | CSB-MP861154HU
- SKU:
 - CSB-MP861154HU
 - Availability:
 - 18 - 28 Working Days
 
Description
Recombinant Human Collectin-11 (COLEC11) | CSB-MP861154HU | Cusabio
Alternative Name(s): Collectin kidney protein 1 Short name:CL-K1
Gene Names: COLEC11
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 26-271aa
Sequence Info: Full Length of Mature Protein
MW: 30.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration
Reference: "Identification and characterization of a novel human collectin CL-K1."Keshi H., Sakamoto T., Kawai T., Ohtani K., Katoh T., Jang S.-J., Motomura W., Yoshizaki T., Fukuda M., Koyama S., Fukuzawa J., Fukuoh A., Yoshida I., Suzuki Y., Wakamiya N.Microbiol. Immunol. 50:1001-1013(2006)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration (By similarity).
Involvement in disease: 3MC syndrome 2 (3MC2)
Subcellular Location: Secreted
Protein Families: COLEC10/COLEC11 family
Tissue Specificity: Ubiquitous.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9BWP8
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM