Recombinant Human Collectin-11 (COLEC11) | CSB-MP861154HU

(No reviews yet) Write a Review
SKU:
CSB-MP861154HU
Availability:
18 - 28 Working Days
  • Recombinant Human Collectin-11 (COLEC11)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £1,040.80

Description

Recombinant Human Collectin-11 (COLEC11) | CSB-MP861154HU | Cusabio

Alternative Name(s): Collectin kidney protein 1 Short name:CL-K1

Gene Names: COLEC11

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 26-271aa

Sequence Info: Full Length of Mature Protein

MW: 30.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration

Reference: "Identification and characterization of a novel human collectin CL-K1."Keshi H., Sakamoto T., Kawai T., Ohtani K., Katoh T., Jang S.-J., Motomura W., Yoshizaki T., Fukuda M., Koyama S., Fukuzawa J., Fukuoh A., Yoshida I., Suzuki Y., Wakamiya N.Microbiol. Immunol. 50:1001-1013(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration (By similarity).

Involvement in disease: 3MC syndrome 2 (3MC2)

Subcellular Location: Secreted

Protein Families: COLEC10/COLEC11 family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BWP8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose