Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial | CSB-YP005725HU

Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial | CSB-YP005725HU | Cusabio

Alternative Name(s): Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473

Gene Names: COL18A1

Research Areas: Cell Adhesion

Organism: Homo sapiens (Human)

AA Sequence: QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1578-1754aa

Sequence Info: Partial

MW: 21.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.

Reference: Complete primary structure of two variant forms of human type XVIII collagen and tissue-specific differences in the expression of the corresponding transcripts.Saarela J., Ylikarppa R., Rehn M., Purmonen S., Pihlajaniemi T.Matrix Biol. 16:319-328(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.

Involvement in disease: Knobloch syndrome 1 (KNO1)

Subcellular Location: Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane

Protein Families: Multiplexin collagen family

Tissue Specificity: Present in multiple organs with highest levels in liver, lung and kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P39060

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM