Recombinant Human Collagen alpha-1 (XI) chain (COL11A1), partial | CSB-YP005716HU

Recombinant Human Collagen alpha-1 (XI) chain (COL11A1), partial | CSB-YP005716HU | Cusabio

Alternative Name(s): COBA1_HUMAN; COL11A1; COLL6; Collagen alpha 1; Collagen alpha-1(XI) chain; collagen XI alpha 1; collagen XI; alpha 1 polypeptide ; collagen; type XI; alpha 1; STL2; STL3; XI chain precursor

Gene Names: XI

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ

Source: Yeast

Tag Info: N-terminal GST-tagged

Expression Region: 532-699aa

Sequence Info: Partial

MW: 42.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.

Involvement in disease: Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Fibrillar collagen family

Tissue Specificity: Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12107

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM