Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial | CSB-EP005741HU1

(No reviews yet) Write a Review
SKU:
CSB-EP005741HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £297.60

Description

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial | CSB-EP005741HU1 | Cusabio

Alternative Name(s): Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1(IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; collagen type IV alpha 1 chain; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; RATOR

Gene Names: COL4A1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 30-167aa

Sequence Info: Partial

MW: 39.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Type IV collagen is the major structural component of glomerular basent mbranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.

Reference: Structural organization of the gene for the alpha 1 chain of human type IV collagen.Soininen R., Huotari M., Ganguly A., Prockop D.J., Tryggvason K.J. Biol. Chem. 264:13565-13571(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.

Involvement in disease: Brain small vessel disease with or without ocular anomalies (BSVD); Hereditary angiopathy with nephropathy aneurysms and muscle cramps (HANAC); Porencephaly 1 (POREN1); Intracerebral hemorrhage (ICH); Tortuosity of retinal arteries (RATOR); Schizencephaly (SCHZC)

Subcellular Location: Secreted, extracellular space, extracellular matrix, basement membrane

Protein Families: Type IV collagen family

Tissue Specificity: Highly expressed in placenta.

Paythway: PI3K-Aktsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02462

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose