Recombinant Human Cold-inducible RNA-binding protein (CIRBP) | CSB-EP613483HU

Recombinant Human Cold-inducible RNA-binding protein (CIRBP) | CSB-EP613483HU | Cusabio

Alternative Name(s): A18 hnRNP (Glycine-rich RNA-binding protein CIRP) (A18HNRNP) (CIRP)

Gene Names: CIRBP

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-172aa

Sequence Info: Full Length

MW: 22.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules, when overexpressed.

Reference: "Post-transcriptional regulation of thioredoxin by the stress inducible heterogeneous ribonucleoprotein A18." Yang R., Weber D.J., Carrier F. Nucleic Acids Res. 34:1224-1236(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14011

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A