Recombinant Human Coagulation factor XI (F11), partial | CSB-EP007916HU

Recombinant Human Coagulation factor XI (F11), partial | CSB-EP007916HU | Cusabio

Alternative Name(s): Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain

Gene Names: F11

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-387aa

Sequence Info: Partial

MW: 45.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Reference: "Revisiting the molecular epidemiology of factor XI deficiency: nine new mutations and an original large 4qTer deletion in western Brittany (France)."Gueguen P., Chauvin A., Quemener-Redon S., Pan-Petesch B., Ferec C., Abgrall J.F., Le Marechal C.Thromb. Haemost. 107:44-50(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Involvement in disease: Factor XI deficiency (FA11D)

Subcellular Location: Secreted

Protein Families: Peptidase S1 family, Plasma kallikrein subfamily

Tissue Specificity: Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.

Paythway: Complementandcoagulationcascades

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P03951

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM