Cusabio Human Recombinants
Recombinant Human CMRF35-like molecule 7 (CD300LB), partial | CSB-YP004919HU
- SKU:
- CSB-YP004919HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human CMRF35-like molecule 7 (CD300LB), partial | CSB-YP004919HU | Cusabio
Alternative Name(s): CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name: IREM-3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 Short name: TREM-5 CD_antigen: CD300b
Gene Names: CD300LB
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 18-151aa
Sequence Info: Extracellular Domain
MW: 17.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Reference: "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Involvement in disease:
Subcellular Location: Cell membrane, Single-pass type I membrane protein
Protein Families: CD300 family
Tissue Specificity: Expressed exclusively in myeloid lineages.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: A8K4G0
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM