Recombinant Human CMRF35-like molecule 1 (CD300LF), partial | CSB-EP819470HU

(No reviews yet) Write a Review
SKU:
CSB-EP819470HU
Availability:
3 - 7 Working Days
  • Recombinant Human CMRF35-like molecule 1 (CD300LF), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human CMRF35-like molecule 1 (CD300LF), partial | CSB-EP819470HU | Cusabio

Alternative Name(s): CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1 ;IREM-1Immunoglobulin superfamily member 13 ;IgSF13NK inhibitory receptor; CD300f

Gene Names: CD300LF

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-156aa

Sequence Info: Extracellular Domain

MW: 19.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.

Reference: IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes.Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.Biochem. Biophys. Res. Commun. 319:920-928(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as an inhibitory receptor for myeloid cells and mast cells

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: CD300 family

Tissue Specificity: Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8TDQ1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose