Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4) , partial | CSB-RP010974h

(No reviews yet) Write a Review
SKU:
CSB-RP010974h
Availability:
13 - 23 Working Days
  • Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4) , partial | CSB-RP010974h | Cusabio

Alternative Name(s): ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta

Gene Names: CHD4

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES

Source: E.coli

Tag Info: N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Expression Region: 1-239aa

Sequence Info: Partial

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.

Reference: The major dermatomyositis specific Mi-2 autoantigen is a presumed helicase involved in transcriptional activation.Seelig H.P., Moosbrugger I., Ehrfeld H., Fink T., Renz M., Genth E.Arthritis Rheum. 38:1389-1399(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.

Involvement in disease: Sifrim-Hitz-Weiss syndrome (SIHIWES)

Subcellular Location: Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families: SNF2/RAD54 helicase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14839

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose