Recombinant Human Cerebellar degeneration-related antigen 1 (CDR1) | CSB-YP005102HU

(No reviews yet) Write a Review
SKU:
CSB-YP005102HU
Availability:
25 - 35 Working Days
£271.20 - £1,076.00

Description

Recombinant Human Cerebellar degeneration-related antigen 1 (CDR1) | CSB-YP005102HU | Cusabio

Alternative Name(s): CDR34

Gene Names: CDR1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGFSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-262aa

Sequence Info: Full Length

MW: 32.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Autoantibodies against CDR1 are found in patients with paraneoplastic cerebellar degeneration.

Reference: "Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in prostate cancer cell lines." Salemi M., Fraggetta F., Galia A., Pepe P., Cimino L., Condorelli R.A., Calogero A.E. Int. J. Biol. Markers 29:e288-90(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51861

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose