Cusabio Human Recombinants
Recombinant Human Cerebellar degeneration-related antigen 1 (CDR1) | CSB-YP005102HU
- SKU:
- CSB-YP005102HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Cerebellar degeneration-related antigen 1 (CDR1) | CSB-YP005102HU | Cusabio
Alternative Name(s): CDR34
Gene Names: CDR1
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGFSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-262aa
Sequence Info: Full Length
MW: 32.6
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Autoantibodies against CDR1 are found in patients with paraneoplastic cerebellar degeneration.
Reference: "Cerebellar degeneration-related autoantigen 1 (CDR1) gene expression in prostate cancer cell lines." Salemi M., Fraggetta F., Galia A., Pepe P., Cimino L., Condorelli R.A., Calogero A.E. Int. J. Biol. Markers 29:e288-90(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P51861
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A