Recombinant Human Cell surface hyaluronidase (TMEM2), partial | CSB-EP023791HU

(No reviews yet) Write a Review
SKU:
CSB-EP023791HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cell surface hyaluronidase (TMEM2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$319.20 - $1,728.00

Description

Recombinant Human Cell surface hyaluronidase (TMEM2), partial | CSB-EP023791HU | Cusabio

Alternative Name(s): Transmembrane protein 2 (KIAA1412)

Gene Names: TMEM2

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 104-250aa

Sequence Info: Partial

MW: 21.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate

Reference: "Refining the DFNB7-DFNB11 deafness locus using intragenic polymorphisms in a novel gene, TMEM2." Scott D.A., Drury S., Sundstrom R.A., Bishop J., Swiderski R.E., Carmi R., Ramesh A., Elbedour K., Srikumari Srisailapathy C.R., Keats B.J., Sheffield V.C., Smith R.J.H. Gene 246:265-274(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein

Protein Families: TMEM2 family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHN6

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose