Recombinant Human CD81 antigen (CD81), partial | CSB-EP004960HU

(No reviews yet) Write a Review
SKU:
CSB-EP004960HU
Availability:
3 - 7 Working Days
  • Recombinant Human CD81 antigen (CD81), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human CD81 antigen (CD81), partial | CSB-EP004960HU | Cusabio

Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ;Tspan-28; CD81

Gene Names: CD81

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 113-201aa

Sequence Info: Extracellular Domain

MW: 25.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

Reference: TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION

Involvement in disease: Immunodeficiency, common variable, 6 (CVID6)

Subcellular Location: Basolateral cell membrane, Multi-pass membrane protein

Protein Families: Tetraspanin (TM4SF) family

Tissue Specificity: Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.

Paythway: Bcellreceptorsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P60033

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose