Recombinant Human CD160 antigen (CD160) (Active) | CSB-AP005221HU

(No reviews yet) Write a Review
SKU:
CSB-AP005221HU
Availability:
5 to 10 Working Days
  • Recombinant Human CD160 antigen (CD160) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$194.40 - $330.00

Description

Recombinant Human CD160 antigen (CD160) (Active) | CSB-AP005221HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : CD160 Antigen; Natural Killer Cell Receptor BY55; CD160; BY55

Gene Names: CD160

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 27-159aa

Sequence Info: INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS

Biological Activity: The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml.

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Receptor showing broad specificity for both classical and non-classical MHC class I molecules.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity: Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95971

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose