Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG), partial | CSB-RP135574h

Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG), partial | CSB-RP135574h | Cusabio

Alternative Name(s): C/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein gamma; CCAAT/enhancer-binding protein gamma; CEBPG; CEBPG_HUMAN; GPE1BP; IG/EBP 1; IG/EBP1

Gene Names: CEBPG

Research Areas: Transcription

Organism: Homo sapiens (Human)

AA Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-148aa

Sequence Info: Partial

MW: 20.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcription factor that binds to the enhancer elent PRE-I (positive regulatory elent-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit th to unusual DNA sites.

Reference: Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.Davydov I.V., Bohmann D., Krammer P.H., Li-Weber M.Gene 161:271-275(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: BZIP family, C/EBP subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P53567

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM