Recombinant Human Cathepsin S (CTSS) | CSB-EP006204HU

(No reviews yet) Write a Review
SKU:
CSB-EP006204HU
Availability:
13 - 23 Working Days
  • Recombinant Human Cathepsin S (CTSS)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Cathepsin S (CTSS) | CSB-EP006204HU | Cusabio

Alternative Name(s): Cathepsin S; CathepsinS; CATS_HUMAN; Ctss

Gene Names: CTSS

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 115-331aa

Sequence Info: Full Length of Mature Protein

MW: 28 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thiol protease. Key protease responsible for the roval of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Reference: Molecular cloning and expression of human alveolar macrophage cathepsin S, an elastinolytic cysteine protease.Shi G.-P., Munger J.S., Meara J.P., Rich D.H., Chapman H.A.J. Biol. Chem. 267:7258-7262(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.

Involvement in disease:

Subcellular Location: Lysosome

Protein Families: Peptidase C1 family

Tissue Specificity:

Paythway: Apoptosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25774

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose