Recombinant Human Cathepsin K (CTSK) | CSB-EP006192HU

(No reviews yet) Write a Review
SKU:
CSB-EP006192HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cathepsin K (CTSK)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Cathepsin K (CTSK) | CSB-EP006192HU | Cusabio

Alternative Name(s): Cathepsin OCathepsin O2;Cathepsin X

Gene Names: CTSK

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 115-329aa

Sequence Info: Full Length of Mature Protein

MW: 27.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation.

Reference: Cathepsin K gene mutations and 1q21 haplotypes in at patients with pycnodysostosis in an outbred population.Haagerup A., Hertz J.M., Christensen M.F., Binderup H., Kruse T.A.Eur. J. Hum. Genet. 8:431-436(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.

Involvement in disease: Pycnodysostosis (PKND)

Subcellular Location: Lysosome

Protein Families: Peptidase C1 family

Tissue Specificity: Predominantly expressed in osteoclasts (bones).

Paythway: Apoptosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43235

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose