Recombinant Human Cathepsin F protein (CTSF), partial | CSB-RP152794h

Recombinant Human Cathepsin F protein (CTSF), partial | CSB-RP152794h | Cusabio

Alternative Name(s): AI481912; CATF_HUMAN; Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf; EC 3.4.22.41

Gene Names: CTSF

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 273-484aa

Sequence Info: Partial

MW: 27.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Reference: Molecular cloning and structural and functional characterization of human cathepsin F, a new cysteine proteinase of the papain family with a long propeptide domain.Santamaria I., Velasco G., Pendas A.M., Paz A., Lopez-Otin C.J. Biol. Chem. 274:13800-13809(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Involvement in disease: Ceroid lipofuscinosis, neuronal, 13 (CLN13)

Subcellular Location: Lysosome

Protein Families: Peptidase C1 family

Tissue Specificity: High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus.

Paythway: Apoptosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UBX1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM